Lineage for d1db9a4 (1db9 A:138-207)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2694554Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 2694555Protein automated matches [190154] (92 species)
    not a true protein
  7. 2694704Species Escherichia coli [311127] (3 PDB entries)
  8. 2694707Domain d1db9a4: 1db9 A:138-207 [302317]
    Other proteins in same PDB: d1db9a3
    automated match to d4i02a2
    protein/DNA complex; complexed with cmp

Details for d1db9a4

PDB Entry: 1db9 (more details), 3 Å

PDB Description: protein-dna recognition and dna deformation revealed in crystal structures of cap-dna complexes
PDB Compounds: (A:) catabolite gene activator protein

SCOPe Domain Sequences for d1db9a4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1db9a4 a.4.5.0 (A:138-207) automated matches {Escherichia coli}
dvtgriaqtllnlakqpdamthpdgmqikitrqeigqivgcsrdtvgrilkmledqnlis
ahgktivvyg

SCOPe Domain Coordinates for d1db9a4:

Click to download the PDB-style file with coordinates for d1db9a4.
(The format of our PDB-style files is described here.)

Timeline for d1db9a4: