SCOPe 2.08: Domain d1db8a4: 1db8 A:138-207

Lineage for d1db8a4 (1db8 A:138-207)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.0: automated matches [191329] (1 protein)
   not a true family

6. Protein automated matches [190154] (92 species)
   not a true protein

7. Species Escherichia coli [311127] (3 PDB entries)

8. Domain d1db8a4: 1db8 A:138-207 [302315]
   Other proteins in same PDB: d1db8a3
   automated match to d4i02a2
   protein/DNA complex; complexed with cmp

Details for d1db8a4

PDB Entry: 1db8, 3 Å

PDB Description: protein-dna recognition and dna deformation revealed in crystal structures of cap-dna complexes

PDB Compounds: (A:) catabolite gene activator protein

SCOPe Domain Sequences for d1db8a4:

Sequence; same for both SEQRES and ATOM records:

>d1db8a4 a.4.5.0 (A:138-207) automated matches {Escherichia coli}
dvtgriaqtllnlakqpdamthpdgmqikitrqeigqivgcsretvgrilkmledqnlis
ahgktivvyg

Timeline for d1db8a4:

• d1db8a4 first appeared in SCOPe 2.06
  
• d1db8a4 appears in SCOPe 2.07