| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
Superfamily c.95.1: Thiolase-like [53901] (3 families) ![]() |
| Family c.95.1.2: Chalcone synthase-like [53914] (15 proteins) |
| Protein Ketoacyl-ACP synthase III (FabH) [53912] (5 species) |
| Species Escherichia coli [TaxId:562] [53913] (14 PDB entries) |
| Domain d1d9bb2: 1d9b B:175-317 [302308] automated match to d1hnja2 |
PDB Entry: 1d9b (more details), 2 Å
SCOPe Domain Sequences for d1d9bb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1d9bb2 c.95.1.2 (B:175-317) Ketoacyl-ACP synthase III (FabH) {Escherichia coli [TaxId: 562]}
isthlhadgsygelltlpnadrvnpensihltmagnevfkvavtelahivdetlaannld
rsqldwlvphqanlriisatakklgmsmdnvvvtldrhgntsaasvpcaldeavrdgrik
pgqlvlleafgggftwgsalvrf
Timeline for d1d9bb2: