Lineage for d1d8ra_ (1d8r A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2903429Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest
  4. 2903430Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) (S)
  5. 2903431Family c.71.1.1: Dihydrofolate reductases [53598] (4 proteins)
  6. 2903757Protein Dihydrofolate reductases, eukaryotic type [53605] (7 species)
  7. 2903779Species Fungus (Pneumocystis carinii) [TaxId:4754] [53608] (25 PDB entries)
  8. 2903789Domain d1d8ra_: 1d8r A: [302304]
    automated match to d1vj3a_
    complexed with ndp, tab

Details for d1d8ra_

PDB Entry: 1d8r (more details), 2.1 Å

PDB Description: structural studies on bio-active compounds. crystal structure and molecular modeling studies on the pneumocystis carinii dihydrofolate reductase cofactor complex with tab, a highly selective antifolate.
PDB Compounds: (A:) protein (dihydrofolate reductase)

SCOPe Domain Sequences for d1d8ra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d8ra_ c.71.1.1 (A:) Dihydrofolate reductases, eukaryotic type {Fungus (Pneumocystis carinii) [TaxId: 4754]}
nqqksltlivalttsygigrsnslpwklkkeisyfkrvtsfvptfdsfesmnvvlmgrkt
wesiplqfrplkgrinvvitrnesldlgngihsaksldhalellyrtygsessvqinrif
viggaqlykaamdhpkldrimatiiykdihcdvffplkfrdkewssvwkkekhsdleswv
gtkvphgkinedgfdyefemwtrdl

SCOPe Domain Coordinates for d1d8ra_:

Click to download the PDB-style file with coordinates for d1d8ra_.
(The format of our PDB-style files is described here.)

Timeline for d1d8ra_: