Lineage for d1d5ka_ (1d5k A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2953608Superfamily d.58.12: eEF-1beta-like [54984] (1 family) (S)
    automatically mapped to Pfam PF00736
  5. 2953609Family d.58.12.1: eEF-1beta-like [54985] (3 proteins)
  6. 2953624Protein automated matches [310835] (1 species)
    not a true protein
  7. 2953625Species Methanobacterium thermoautotrophicum [311125] (1 PDB entry)
  8. 2953626Domain d1d5ka_: 1d5k A: [302303]
    automated match to d1gh8a_

Details for d1d5ka_

PDB Entry: 1d5k (more details)

PDB Description: solution structure of the archaeal translation elongation factor 1beta from methanobacterium thermoautotrophicum
PDB Compounds: (A:) translation elongation factor 1beta

SCOPe Domain Sequences for d1d5ka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d5ka_ d.58.12.1 (A:) automated matches {Methanobacterium thermoautotrophicum}
mgdvvatikvmpespdvdlealkkeiqeripegtelhkideepiafglvalnvmvvvgda
eggteaaeeslsgiegvsnievtdvrrlm

SCOPe Domain Coordinates for d1d5ka_:

Click to download the PDB-style file with coordinates for d1d5ka_.
(The format of our PDB-style files is described here.)

Timeline for d1d5ka_: