![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.12: eEF-1beta-like [54984] (1 family) ![]() automatically mapped to Pfam PF00736 |
![]() | Family d.58.12.1: eEF-1beta-like [54985] (3 proteins) |
![]() | Protein automated matches [310835] (1 species) not a true protein |
![]() | Species Methanobacterium thermoautotrophicum [311125] (1 PDB entry) |
![]() | Domain d1d5ka_: 1d5k A: [302303] automated match to d1gh8a_ |
PDB Entry: 1d5k (more details)
SCOPe Domain Sequences for d1d5ka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1d5ka_ d.58.12.1 (A:) automated matches {Methanobacterium thermoautotrophicum} mgdvvatikvmpespdvdlealkkeiqeripegtelhkideepiafglvalnvmvvvgda eggteaaeeslsgiegvsnievtdvrrlm
Timeline for d1d5ka_: