Lineage for d1d4qa1 (1d4q A:2-102)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2371691Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 2371692Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
    Pfam PF00041
  6. 2371700Protein Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors [49289] (1 species)
    duplication: consists of four similar domains; dimerizes by swapping the C-terminal strands of domains 1 and 3
  7. 2371701Species Human (Homo sapiens) [TaxId:9606] [49290] (5 PDB entries)
  8. 2371719Domain d1d4qa1: 1d4q A:2-102 [302301]
    Other proteins in same PDB: d1d4qa2
    automated match to d1c8pa_

Details for d1d4qa1

PDB Entry: 1d4q (more details)

PDB Description: nmr structure of the ligand binding domain of the common beta-chain in the gm-csf, il-3 and il-5 receptors
PDB Compounds: (A:) cytokine receptor common beta chain

SCOPe Domain Sequences for d1d4qa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d4qa1 b.1.2.1 (A:2-102) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]}
iqmappslnvtkdgdsyslrwetmkmryehidhtfeiqyrkdtatwkdsktetlqnahsm
alpalepstrywarvrvrtsrtgyngiwsewsearswdtes

SCOPe Domain Coordinates for d1d4qa1:

Click to download the PDB-style file with coordinates for d1d4qa1.
(The format of our PDB-style files is described here.)

Timeline for d1d4qa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1d4qa2