SCOP 1.67: Domain d1bvue1: 1bvu E:181-418

Lineage for d1bvue1 (1bvu E:181-418)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (11 families)

5. Family c.2.1.7: Aminoacid dehydrogenase-like, C-terminal domain [51883] (10 proteins)
   extra N-terminal helix displaces the C-terminal helix (following strand 6) from its usual position creating a family nicotineamide-binding site

6. Protein Glutamate dehydrogenase [51884] (7 species)

7. Species Archaeon Thermococcus litoralis [TaxId:2265] [51887] (1 PDB entry)

8. Domain d1bvue1: 1bvu E:181-418 [30230]
   Other proteins in same PDB: d1bvua2, d1bvub2, d1bvuc2, d1bvud2, d1bvue2, d1bvuf2

Details for d1bvue1

PDB Entry: 1bvu, 2.5 Å

PDB Description: glutamate dehydrogenase from thermococcus litoralis

SCOP Domain Sequences for d1bvue1:

Sequence; same for both SEQRES and ATOM records:

>d1bvue1 c.2.1.7 (E:181-418) Glutamate dehydrogenase {Archaeon Thermococcus litoralis}
ggivarmdatargasytvreaakalgmdlkgktiaiqgygnagyymakimseeygmkvva
vsdtkggiynpdglnadevlawkkktgsvkdfpgatnitneellelevdvlapsaieevi
tkknadnikakivaelangpttpeadeilyekgiliipdflcnaggvtvsyfewvqnitg
dywtveetrakldkkmtkafwdvynthkekninmrdaayvvavsrvyqamkdrgwikk

Timeline for d1bvue1:

• d1bvue1 first appeared (with stable ids) in SCOP 1.55
  
• d1bvue1 appears in SCOP 1.65
  
• d1bvue1 appears in SCOP 1.69
  
• d1bvue1 appears in the current release, SCOPe 2.08