Class g: Small proteins [56992] (100 folds) |
Fold g.29: Type X cellulose binding domain, CBDX [57614] (1 superfamily) disulfide-rich, alpha+beta |
Superfamily g.29.1: Type X cellulose binding domain, CBDX [57615] (1 family) |
Family g.29.1.1: Type X cellulose binding domain, CBDX [57616] (1 protein) |
Protein Endo-1;4-beta-xylanase A CBDX [57617] (2 species) |
Species Pseudomonas fluorescens [311124] (1 PDB entry) |
Domain d1ct7a1: 1ct7 A:21-69 [302296] Other proteins in same PDB: d1ct7a2 automated match to d1qlda_ |
PDB Entry: 1ct7 (more details)
SCOPe Domain Sequences for d1ct7a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ct7a1 g.29.1.1 (A:21-69) Endo-1;4-beta-xylanase A CBDX {Pseudomonas fluorescens} gnqqcnwygtlyplcvtttngwgwedqrsciarstcaaqpapfgivgsg
Timeline for d1ct7a1: