Lineage for d1cmwa8 (1cmw A:423-832)

  1. Root: SCOPe 2.07
  2. 2618030Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2622069Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 2622070Superfamily e.8.1: DNA/RNA polymerases [56672] (8 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 2622071Family e.8.1.1: DNA polymerase I [56673] (5 proteins)
  6. 2622072Protein DNA polymerase I (Klenow fragment) [56674] (3 species)
  7. 2622138Species Thermus aquaticus [TaxId:271] [56676] (29 PDB entries)
  8. 2622153Domain d1cmwa8: 1cmw A:423-832 [302291]
    Other proteins in same PDB: d1cmwa5, d1cmwa6, d1cmwa7
    automated match to d1bgxt4

Details for d1cmwa8

PDB Entry: 1cmw (more details), 2.6 Å

PDB Description: crystal structure of taq dna-polymerase shows a new orientation for the structure-specific nuclease domain
PDB Compounds: (A:) protein (DNA polymerase I)

SCOPe Domain Sequences for d1cmwa8:

Sequence, based on SEQRES records: (download)

>d1cmwa8 e.8.1.1 (A:423-832) DNA polymerase I (Klenow fragment) {Thermus aquaticus [TaxId: 271]}
eerllwlyreverplsavlahmeatgvrldvaylralslevaeeiarleaevfrlaghpf
nlnsrdqlervlfdelglpaigktektgkrstsaavlealreahpivekilqyreltklk
styidplpdlihprtgrlhtrfnqtatatgrlsssdpnlqnipvrtplgqrirrafiaee
gwllvaldysqielrvlahlsgdenlirvfqegrdihtetaswmfgvpreavdplmrraa
ktinfgvlygmsahrlsqelaipyeeaqafieryfqsfpkvrawiektleegrrrgyvet
lfgrrryvpdlearvksvreaaermafnmpvqgtaadlmklamvklfprleemgarmllq
vhdelvleapkeraeavarlakevmegvyplavplevevgigedwlsake

Sequence, based on observed residues (ATOM records): (download)

>d1cmwa8 e.8.1.1 (A:423-832) DNA polymerase I (Klenow fragment) {Thermus aquaticus [TaxId: 271]}
eerllwlyreverplsavlahmeatgvrldvaylralslevaleaevfrlaghpfnlnsr
dqlervlfdelglpaigktektgkrstsaavlealreahpivekilqyreltklkstyid
plpdlihprtgrlhtrfnqtatatgrlsssdpnlqnipvrtplgqrirrafiaeegwllv
aldysqielrvlahlsgdenlirvfqegrdihtetaswmfgvpreavdplmrraaktinf
gvlygmsahrlsqelaipyeeaqafieryfqsfpkvrawiektleegrrrgyvetlfgrr
ryvpdlearvksvreaaermafnmpvqgtaadlmklamvklfprleemgarmllqvhdel
vleapkeraeavarlakevmegvyplavplevevgigedwlsake

SCOPe Domain Coordinates for d1cmwa8:

Click to download the PDB-style file with coordinates for d1cmwa8.
(The format of our PDB-style files is described here.)

Timeline for d1cmwa8: