Lineage for d1bvud1 (1bvu D:181-418)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 387036Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 387037Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (11 families) (S)
  5. 388514Family c.2.1.7: Aminoacid dehydrogenase-like, C-terminal domain [51883] (10 proteins)
    extra N-terminal helix displaces the C-terminal helix (following strand 6) from its usual position creating a family nicotineamide-binding site
  6. 388515Protein Glutamate dehydrogenase [51884] (7 species)
  7. 388520Species Archaeon Thermococcus litoralis [TaxId:2265] [51887] (1 PDB entry)
  8. 388524Domain d1bvud1: 1bvu D:181-418 [30229]
    Other proteins in same PDB: d1bvua2, d1bvub2, d1bvuc2, d1bvud2, d1bvue2, d1bvuf2

Details for d1bvud1

PDB Entry: 1bvu (more details), 2.5 Å

PDB Description: glutamate dehydrogenase from thermococcus litoralis

SCOP Domain Sequences for d1bvud1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bvud1 c.2.1.7 (D:181-418) Glutamate dehydrogenase {Archaeon Thermococcus litoralis}
ggivarmdatargasytvreaakalgmdlkgktiaiqgygnagyymakimseeygmkvva
vsdtkggiynpdglnadevlawkkktgsvkdfpgatnitneellelevdvlapsaieevi
tkknadnikakivaelangpttpeadeilyekgiliipdflcnaggvtvsyfewvqnitg
dywtveetrakldkkmtkafwdvynthkekninmrdaayvvavsrvyqamkdrgwikk

SCOP Domain Coordinates for d1bvud1:

Click to download the PDB-style file with coordinates for d1bvud1.
(The format of our PDB-style files is described here.)

Timeline for d1bvud1: