Lineage for d1cmwa6 (1cmw A:174-289)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2001088Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 2001760Superfamily a.60.7: 5' to 3' exonuclease, C-terminal subdomain [47807] (2 families) (S)
  5. 2001761Family a.60.7.1: 5' to 3' exonuclease, C-terminal subdomain [47808] (4 proteins)
  6. 2001762Protein 5' to 3' exonuclease domain of DNA polymerase Taq [47811] (1 species)
  7. 2001763Species Thermus aquaticus [TaxId:271] [47812] (4 PDB entries)
  8. 2001764Domain d1cmwa6: 1cmw A:174-289 [302289]
    Other proteins in same PDB: d1cmwa5, d1cmwa7, d1cmwa8
    automated match to d1bgxt1

Details for d1cmwa6

PDB Entry: 1cmw (more details), 2.6 Å

PDB Description: crystal structure of taq dna-polymerase shows a new orientation for the structure-specific nuclease domain
PDB Compounds: (A:) protein (DNA polymerase I)

SCOPe Domain Sequences for d1cmwa6:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cmwa6 a.60.7.1 (A:174-289) 5' to 3' exonuclease domain of DNA polymerase Taq {Thermus aquaticus [TaxId: 271]}
lrpdqwadyraltgdesdnlpgvkgigektarklleewgsleallknldrlkpairekil
ahmddlklswdlakvrtdlplevdfakrrepdrerlraflerlefgsllhefglle

SCOPe Domain Coordinates for d1cmwa6:

Click to download the PDB-style file with coordinates for d1cmwa6.
(The format of our PDB-style files is described here.)

Timeline for d1cmwa6: