Lineage for d1cmwa5 (1cmw A:10-173)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2169006Fold c.120: PIN domain-like [88722] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 5 strands, order 32145
  4. 2169007Superfamily c.120.1: PIN domain-like [88723] (3 families) (S)
  5. 2169068Family c.120.1.2: 5' to 3' exonuclease catalytic domain [53045] (4 proteins)
    contains an alpha-helical arch and additional strand 6 antiparallel to the rest; strand order 321456; similarity to the resolvase-like fold
  6. 2169069Protein 5' to 3' exonuclease domain of DNA polymerase Taq [53048] (1 species)
  7. 2169070Species Thermus aquaticus [TaxId:271] [53049] (4 PDB entries)
  8. 2169071Domain d1cmwa5: 1cmw A:10-173 [302288]
    Other proteins in same PDB: d1cmwa6, d1cmwa7, d1cmwa8
    automated match to d1bgxt2

Details for d1cmwa5

PDB Entry: 1cmw (more details), 2.6 Å

PDB Description: crystal structure of taq dna-polymerase shows a new orientation for the structure-specific nuclease domain
PDB Compounds: (A:) protein (DNA polymerase I)

SCOPe Domain Sequences for d1cmwa5:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cmwa5 c.120.1.2 (A:10-173) 5' to 3' exonuclease domain of DNA polymerase Taq {Thermus aquaticus [TaxId: 271]}
pkgrvllvdghhlayrtfhalkglttsrgepvqavygfaksllkalkedgdavivvfdak
apsfrheayggykagraptpedfprqlalikelvdllglarlevpgyeaddvlaslakka
ekegyevriltadkdlyqllsdrihvlhpegylitpawlwekyg

SCOPe Domain Coordinates for d1cmwa5:

Click to download the PDB-style file with coordinates for d1cmwa5.
(The format of our PDB-style files is described here.)

Timeline for d1cmwa5: