![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.120: PIN domain-like [88722] (1 superfamily) 3 layers, a/b/a; core: parallel beta-sheet of 5 strands, order 32145 |
![]() | Superfamily c.120.1: PIN domain-like [88723] (4 families) ![]() |
![]() | Family c.120.1.2: 5' to 3' exonuclease catalytic domain [53045] (4 proteins) contains an alpha-helical arch and additional strand 6 antiparallel to the rest; strand order 321456; similarity to the resolvase-like fold |
![]() | Protein 5' to 3' exonuclease domain of DNA polymerase Taq [53048] (1 species) |
![]() | Species Thermus aquaticus [TaxId:271] [53049] (4 PDB entries) |
![]() | Domain d1cmwa5: 1cmw A:10-173 [302288] Other proteins in same PDB: d1cmwa6, d1cmwa7, d1cmwa8 automated match to d1bgxt2 has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1cmw (more details), 2.6 Å
SCOPe Domain Sequences for d1cmwa5:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cmwa5 c.120.1.2 (A:10-173) 5' to 3' exonuclease domain of DNA polymerase Taq {Thermus aquaticus [TaxId: 271]} pkgrvllvdghhlayrtfhalkglttsrgepvqavygfaksllkalkedgdavivvfdak apsfrheayggykagraptpedfprqlalikelvdllglarlevpgyeaddvlaslakka ekegyevriltadkdlyqllsdrihvlhpegylitpawlwekyg
Timeline for d1cmwa5: