Lineage for d1chrb4 (1chr B:127-370)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2836768Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 2836928Family c.1.11.2: D-glucarate dehydratase-like [51609] (15 proteins)
  6. 2837122Protein automated matches [226997] (13 species)
    not a true protein
  7. 2837183Species Cupriavidus necator [TaxId:106590] [311123] (1 PDB entry)
  8. 2837185Domain d1chrb4: 1chr B:127-370 [302287]
    Other proteins in same PDB: d1chra3, d1chrb3
    automated match to d2chra1
    complexed with cl, mn

Details for d1chrb4

PDB Entry: 1chr (more details), 3 Å

PDB Description: crystal structure of chloromuconate cycloisomerase from alcaligenes eutrophus jmp134 (pjp4) at 3 angstroms resolution
PDB Compounds: (B:) chloromuconate cycloisomerase

SCOPe Domain Sequences for d1chrb4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1chrb4 c.1.11.2 (B:127-370) automated matches {Cupriavidus necator [TaxId: 106590]}
plrsaipiawtlasgdtkrdldsavemierrrhnrfkvklgfrspqddlihmealsnslg
skaylrvdvnqawdeqvasvyipelealgvelieqpvgrentqalrrlsdnnrvaimade
slstlasafdlardrsvdvfslklcnmggvsatqkiaavaeasgiasyggtmldstigts
valqlystvpslpfgceligpfvladtlshepleirdyelqvptgvghgmtldedkvrqy
arvs

SCOPe Domain Coordinates for d1chrb4:

Click to download the PDB-style file with coordinates for d1chrb4.
(The format of our PDB-style files is described here.)

Timeline for d1chrb4:

View in 3D
Domains from same chain:
(mouse over for more information)
d1chrb3