SCOPe 2.06: Domain d1chrb3: 1chr B:1-126

Lineage for d1chrb3 (1chr B:1-126)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
   beta(3)-alpha(3); meander and up-and-down bundle

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families)

5. Family d.54.1.0: automated matches [227195] (1 protein)
   not a true family

6. Protein automated matches [226922] (88 species)
   not a true protein

7. Species Cupriavidus necator [TaxId:106590] [311122] (1 PDB entry)

8. Domain d1chrb3: 1chr B:1-126 [302286]
   Other proteins in same PDB: d1chra4, d1chrb4
   automated match to d2chra2
   complexed with cl, mn

Details for d1chrb3

PDB Entry: 1chr, 3 Å

PDB Description: crystal structure of chloromuconate cycloisomerase from alcaligenes eutrophus jmp134 (pjp4) at 3 angstroms resolution

PDB Compounds: (B:) chloromuconate cycloisomerase

SCOPe Domain Sequences for d1chrb3:

Sequence; same for both SEQRES and ATOM records:

>d1chrb3 d.54.1.0 (B:1-126) automated matches {Cupriavidus necator [TaxId: 106590]}
mkidaieavivdvptkrpiqmsittvhqqsyvivrvyseglvgvgeggsvggpvwsaeca
etikiiverylaphllgtdafnvsgalqtmaravtgnasakaavemalldlkaralgvsi
aellgg

Timeline for d1chrb3:

• d1chrb3 is new in SCOPe 2.06-stable
  
• d1chrb3 appears in SCOPe 2.07
  
• d1chrb3 appears in the current release, SCOPe 2.08