| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) ![]() binds metal ion (magnesium or manganese) in conserved site inside barrel N-terminal alpha+beta domain is common to this superfamily |
| Family c.1.11.2: D-glucarate dehydratase-like [51609] (15 proteins) |
| Protein automated matches [226997] (13 species) not a true protein |
| Species Cupriavidus necator [TaxId:106590] [311123] (1 PDB entry) |
| Domain d1chra4: 1chr A:127-370 [302285] Other proteins in same PDB: d1chra3, d1chrb3 automated match to d2chra1 complexed with cl, mn |
PDB Entry: 1chr (more details), 3 Å
SCOPe Domain Sequences for d1chra4:
Sequence; same for both SEQRES and ATOM records: (download)
>d1chra4 c.1.11.2 (A:127-370) automated matches {Cupriavidus necator [TaxId: 106590]}
plrsaipiawtlasgdtkrdldsavemierrrhnrfkvklgfrspqddlihmealsnslg
skaylrvdvnqawdeqvasvyipelealgvelieqpvgrentqalrrlsdnnrvaimade
slstlasafdlardrsvdvfslklcnmggvsatqkiaavaeasgiasyggtmldstigts
valqlystvpslpfgceligpfvladtlshepleirdyelqvptgvghgmtldedkvrqy
arvs
Timeline for d1chra4: