Lineage for d1ch6e1 (1ch6 E:6-208)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2466799Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
    core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134
  4. 2466800Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families) (S)
  5. 2466801Family c.58.1.1: Aminoacid dehydrogenases [53224] (4 protein domains)
    dimerisation domain; contains additional structures including two extra N-terminal strands in the beta-sheet
  6. 2466802Protein Glutamate dehydrogenase [53225] (8 species)
  7. 2466810Species Cow (Bos taurus) [TaxId:9913] [53230] (8 PDB entries)
  8. 2466824Domain d1ch6e1: 1ch6 E:6-208 [302280]
    Other proteins in same PDB: d1ch6a2, d1ch6e2, d1ch6f2
    automated match to d1hwza2
    complexed with glu, gtp, nad

Details for d1ch6e1

PDB Entry: 1ch6 (more details), 2.9 Å

PDB Description: crystal structure of bovine liver glutamate dehydrogenase complexed with gtp, nadh, and l-glutamic acid
PDB Compounds: (E:) protein (glutamate dehydrogenase)

SCOPe Domain Sequences for d1ch6e1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ch6e1 c.58.1.1 (E:6-208) Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 9913]}
dpnffkmvegffdrgasivedklvedlktrqtqeqkrnrvrgilriikpcnhvlslsfpi
rrddgsweviegyraqhshqrtpckggirystdvsvdevkalaslmtykcavvdvpfgga
kagvkinpknytdedlekitrrftmelakkgfigpgvdvpapnmstgeremswiadtyas
tighydinahacvtgkpisqggi

SCOPe Domain Coordinates for d1ch6e1:

Click to download the PDB-style file with coordinates for d1ch6e1.
(The format of our PDB-style files is described here.)

Timeline for d1ch6e1: