Lineage for d1cf6b5 (1cf6 B:149-334)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2612756Fold d.218: Nucleotidyltransferase [81302] (1 superfamily)
    core: alpha-beta-turn-beta-X-beta-(alpha); mixed beta-sheet, order of core strands: 123
  4. 2612757Superfamily d.218.1: Nucleotidyltransferase [81301] (16 families) (S)
  5. 2612791Family d.218.1.2: DNA polymerase beta-like [81300] (5 proteins)
    insert X in the core is an alpha-beta(2) unit; mixed 5-stranded sheet, order: 12543; contains extra C-terminal alpha+beta subdomain
  6. 2613033Protein automated matches [254484] (3 species)
    not a true protein
  7. 2613070Species Norway rat (Rattus norvegicus) [TaxId:10116] [255608] (2 PDB entries)
  8. 2613073Domain d1cf6b5: 1cf6 B:149-334 [302277]
    Other proteins in same PDB: d1cf6a3, d1cf6a4, d1cf6b3, d1cf6b4
    automated match to d4klia3
    protein/DNA complex; complexed with cr, ucp

Details for d1cf6b5

PDB Entry: 1cf6 (more details), 3.1 Å

PDB Description: structure of dna polymerase beta/dna template-primer/utp phosphonate intermediate complex--potential insight into the molecular basis of fidelity
PDB Compounds: (B:) protein (DNA polymerase beta)

SCOPe Domain Sequences for d1cf6b5:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cf6b5 d.218.1.2 (B:149-334) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
ripreemlqmqdivlnevkkldpeyiatvcgsfrrgaessgdmdvllthpnftsesskqp
kllhrvveqlqkvrfitdtlskgetkfmgvcqlpsendeneyphrridirlipkdqyycg
vlyftgsdifnknmrahalekgftineytirplgvtgvageplpvdseqdifdyiqwryr
epkdrs

SCOPe Domain Coordinates for d1cf6b5:

Click to download the PDB-style file with coordinates for d1cf6b5.
(The format of our PDB-style files is described here.)

Timeline for d1cf6b5: