SCOPe 2.08: Domain d1cf6b5: 1cf6 B:149-334

Lineage for d1cf6b5 (1cf6 B:149-334)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.218: Nucleotidyltransferase [81302] (1 superfamily)
   core: alpha-beta-turn-beta-X-beta-(alpha); mixed beta-sheet, order of core strands: 123

4. Superfamily d.218.1: Nucleotidyltransferase [81301] (16 families)

5. Family d.218.1.2: DNA polymerase beta-like [81300] (5 proteins)
   insert X in the core is an alpha-beta(2) unit; mixed 5-stranded sheet, order: 12543; contains extra C-terminal alpha+beta subdomain

6. Protein automated matches [254484] (3 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [255608] (2 PDB entries)

8. Domain d1cf6b5: 1cf6 B:149-334 [302277]
   Other proteins in same PDB: d1cf6a3, d1cf6a4, d1cf6b3, d1cf6b4
   automated match to d4klia3
   protein/DNA complex; complexed with cr, ucp

Details for d1cf6b5

PDB Entry: 1cf6, 3.1 Å

PDB Description: structure of dna polymerase beta/dna template-primer/utp phosphonate intermediate complex--potential insight into the molecular basis of fidelity

PDB Compounds: (B:) protein (DNA polymerase beta)

SCOPe Domain Sequences for d1cf6b5:

Sequence; same for both SEQRES and ATOM records:

>d1cf6b5 d.218.1.2 (B:149-334) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
ripreemlqmqdivlnevkkldpeyiatvcgsfrrgaessgdmdvllthpnftsesskqp
kllhrvveqlqkvrfitdtlskgetkfmgvcqlpsendeneyphrridirlipkdqyycg
vlyftgsdifnknmrahalekgftineytirplgvtgvageplpvdseqdifdyiqwryr
epkdrs

Timeline for d1cf6b5:

• d1cf6b5 first appeared in SCOPe 2.06
  
• d1cf6b5 appears in SCOPe 2.07