Class a: All alpha proteins [46456] (289 folds) |
Fold a.60: SAM domain-like [47768] (16 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
Superfamily a.60.12: PsbU/PolX domain-like [81585] (3 families) contains one classic and one pseudo HhH motifs |
Family a.60.12.0: automated matches [254215] (1 protein) not a true family |
Protein automated matches [254483] (3 species) not a true protein |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [255607] (2 PDB entries) |
Domain d1cf6b4: 1cf6 B:92-148 [302276] Other proteins in same PDB: d1cf6a3, d1cf6a5, d1cf6b3, d1cf6b5 automated match to d4klia2 protein/DNA complex; complexed with cr, ucp |
PDB Entry: 1cf6 (more details), 3.1 Å
SCOPe Domain Sequences for d1cf6b4:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cf6b4 a.60.12.0 (B:92-148) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]} dtsssinfltrvtgigpsaarklvdegiktledlrknedklnhhqriglkyfedfek
Timeline for d1cf6b4: