![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.60: SAM domain-like [47768] (17 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
![]() | Superfamily a.60.6: DNA polymerase beta, N-terminal domain-like [47802] (2 families) ![]() contains one classic and one pseudo HhH motifs |
![]() | Family a.60.6.0: automated matches [254214] (1 protein) not a true family |
![]() | Protein automated matches [254482] (3 species) not a true protein |
![]() | Species Rattus norvegicus [311121] (1 PDB entry) |
![]() | Domain d1cf6b3: 1cf6 B:10-91 [302275] Other proteins in same PDB: d1cf6a4, d1cf6a5, d1cf6b4, d1cf6b5 automated match to d1tv9a1 protein/DNA complex; complexed with cr, ucp |
PDB Entry: 1cf6 (more details), 3.1 Å
SCOPe Domain Sequences for d1cf6b3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cf6b3 a.60.6.0 (B:10-91) automated matches {Rattus norvegicus} tlnggitdmlvelanfeknvsqaihkynayrkaasviakyphkiksgaeakklpgvgtki aekideflatgklrklekirqd
Timeline for d1cf6b3: