SCOPe 2.07: Domain d1c0hb_: 1c0h B:

Lineage for d1c0hb_ (1c0h B:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Hemoglobin, beta-chain [46500] (26 species)

7. Species Bar-headed goose (Anser indicus) [TaxId:8846] [46509] (4 PDB entries)

8. Domain d1c0hb_: 1c0h B: [302268]
   Other proteins in same PDB: d1c0ha_
   automated match to d1a4fb_
   complexed with hem

Details for d1c0hb_

PDB Entry: 1c0h, 2.3 Å

PDB Description: bar-headed goose hemoglobin (aquomet form)

PDB Compounds: (B:) protein (hemoglobin (beta chain))

SCOPe Domain Sequences for d1c0hb_:

Sequence; same for both SEQRES and ATOM records:

>d1c0hb_ a.1.1.2 (B:) Hemoglobin, beta-chain {Bar-headed goose (Anser indicus) [TaxId: 8846]}
vhwsaeekqlitglwgkvnvadcgaealarllivypwtqrffssfgnlssptailgnpmv
rahgkkvltsfgdavknldnikntfaqlselhcdklhvdpenfrllgdiliivlaahfak
eftpdcqaawqklvrvvahalarkyh

Timeline for d1c0hb_:

• d1c0hb_ first appeared in SCOPe 2.06
  
• d1c0hb_ appears in the current release, SCOPe 2.08