Lineage for d1c0db_ (1c0d B:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2093018Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2093694Family c.1.8.3: beta-glycanases [51487] (27 proteins)
    consist of a number of sequence families
  6. 2094013Protein Endocellulase E1 [51497] (1 species)
  7. 2094014Species Acidothermus cellulolyticus [TaxId:28049] [51498] (3 PDB entries)
  8. 2094018Domain d1c0db_: 1c0d B: [302266]
    automated match to d1ecea_
    mutant

Details for d1c0db_

PDB Entry: 1c0d (more details), 2.4 Å

PDB Description: endocellulase e1 from acidothermus cellulolyticus mutant y245g
PDB Compounds: (B:) endocellulase e1 from a. cellulolyticus

SCOPe Domain Sequences for d1c0db_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c0db_ c.1.8.3 (B:) Endocellulase E1 {Acidothermus cellulolyticus [TaxId: 28049]}
agggywhtsgreildannvpvriaginwfgfetcnyvvhglwsrdyrsmldqikslgynt
irlpysddilkpgtmpnsinfyqmnqdlqgltslqvmdkivayagqiglriildrhrpdc
sgqsalwytssvseatwisdlqalaqrykgnptvvgfdlhnephdpacwgcgdpsidwrl
aaeragnavlsvnpnllifvegvqsyngdsywwggnlqgagqypvvlnvpnrlvysahdy
atsvgpqtwfsdptfpnnmpgiwnknwgylfnqniapvwlgefgttlqsttdqtwlktlv
qylrptaqygadsfqwtfwswnpdsgdtggilkddwqtvdtdkdgylapikssifdpv

SCOPe Domain Coordinates for d1c0db_:

Click to download the PDB-style file with coordinates for d1c0db_.
(The format of our PDB-style files is described here.)

Timeline for d1c0db_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1c0da_