Lineage for d1bv5a_ (1bv5 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2970038Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 2970344Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families) (S)
    alpha-beta(2)-alpha(2)-beta(3)
  5. 2970442Family d.110.3.2: Heme-binding PAS domain [55789] (3 proteins)
  6. 2970490Protein automated matches [190567] (1 species)
    not a true protein
  7. 2970491Species Bradyrhizobium japonicum [TaxId:375] [187558] (3 PDB entries)
  8. 2970493Domain d1bv5a_: 1bv5 A: [302259]
    automated match to d1drma_
    complexed with cn, hem

Details for d1bv5a_

PDB Entry: 1bv5 (more details), 2.7 Å

PDB Description: crystal structure of fixl heme domain complexed with cn
PDB Compounds: (A:) protein (histidine kinase)

SCOPe Domain Sequences for d1bv5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bv5a_ d.110.3.2 (A:) automated matches {Bradyrhizobium japonicum [TaxId: 375]}
damividghgiiqlfstaaerlfgwseleaigqnvnilmpepdrsrhdsyisryrttsdp
hiigigrivtgkrrdgttfpmhlsigemqsggepyftgfvrdltehqqtqarlqelq

SCOPe Domain Coordinates for d1bv5a_:

Click to download the PDB-style file with coordinates for d1bv5a_.
(The format of our PDB-style files is described here.)

Timeline for d1bv5a_: