![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.60: SAM domain-like [47768] (17 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
![]() | Superfamily a.60.1: SAM/Pointed domain [47769] (4 families) ![]() |
![]() | Family a.60.1.1: Pointed domain [47770] (7 proteins) |
![]() | Protein Ets-1 transcription factor pointed domain [47771] (1 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [47772] (2 PDB entries) |
![]() | Domain d1bqva_: 1bqv A: [302246] automated match to d2jv3a_ |
PDB Entry: 1bqv (more details)
SCOPe Domain Sequences for d1bqva_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bqva_ a.60.1.1 (A:) Ets-1 transcription factor pointed domain {Mouse (Mus musculus) [TaxId: 10090]} mecadvplltpsskemmsqalkatfsgftkeqqrlgipkdprqwtethvrdwvmwavnef slkgvdfqkfcmsgaalcalgkecflelapdfvgdilwehleilqkedvk
Timeline for d1bqva_: