Lineage for d1bqva_ (1bqv A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2715427Fold a.60: SAM domain-like [47768] (17 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 2715428Superfamily a.60.1: SAM/Pointed domain [47769] (4 families) (S)
  5. 2715429Family a.60.1.1: Pointed domain [47770] (7 proteins)
  6. 2715436Protein Ets-1 transcription factor pointed domain [47771] (1 species)
  7. 2715437Species Mouse (Mus musculus) [TaxId:10090] [47772] (2 PDB entries)
  8. 2715439Domain d1bqva_: 1bqv A: [302246]
    automated match to d2jv3a_

Details for d1bqva_

PDB Entry: 1bqv (more details)

PDB Description: pointed domain and map kinase phosphorylation site from murine ets-1 transcription factor, nmr, 28 structures
PDB Compounds: (A:) ets-1

SCOPe Domain Sequences for d1bqva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bqva_ a.60.1.1 (A:) Ets-1 transcription factor pointed domain {Mouse (Mus musculus) [TaxId: 10090]}
mecadvplltpsskemmsqalkatfsgftkeqqrlgipkdprqwtethvrdwvmwavnef
slkgvdfqkfcmsgaalcalgkecflelapdfvgdilwehleilqkedvk

SCOPe Domain Coordinates for d1bqva_:

Click to download the PDB-style file with coordinates for d1bqva_.
(The format of our PDB-style files is described here.)

Timeline for d1bqva_: