![]() | Class c: Alpha and beta proteins (a/b) [51349] (121 folds) |
![]() | Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
![]() | Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (10 families) ![]() |
![]() | Family c.2.1.7: Aminoacid dehydrogenase-like, C-terminal domain [51883] (10 proteins) extra N-terminal helix displaces the C-terminal helix (following strand 6) from its usual position creating a family nicotineamide-binding site |
![]() | Protein Glutamate dehydrogenase [51884] (7 species) |
![]() | Species Archaeon Pyrococcus furiosus [TaxId:2261] [51886] (1 PDB entry) |
![]() | Domain d1gtmb1: 1gtm B:181-419 [30224] Other proteins in same PDB: d1gtma2, d1gtmb2, d1gtmc2 |
PDB Entry: 1gtm (more details), 2.2 Å
SCOP Domain Sequences for d1gtmb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gtmb1 c.2.1.7 (B:181-419) Glutamate dehydrogenase {Archaeon Pyrococcus furiosus} ggslgrieatargasytireaakvlgwdtlkgktiaiqgygnagyylakimsedfgmkvv avsdskggiynpdglnadevlkwknehgsvkdfpgatnitneellelevdvlapaaieev itkknadnikakivaevangpvtpeadeilfekgilqipdflcnaggvtvsyfewvqnit gyywtieevrerldkkmtkafydvyniakeknihmrdaayvvavqrvyqamldrgwvkh
Timeline for d1gtmb1:
![]() Domains from other chains: (mouse over for more information) d1gtma1, d1gtma2, d1gtmc1, d1gtmc2 |