| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (27 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
| Family b.1.18.9: Transglutaminase N-terminal domain [81289] (1 protein) |
| Protein Transglutaminase N-terminal domain [49235] (4 species) elaborated with many loop insertions in the common fold |
| Species Human (Homo sapiens), blood isozyme [TaxId:9606] [49236] (9 PDB entries) Coagulation factor XIII |
| Domain d1bl2b1: 1bl2 B:10-190 [302235] Other proteins in same PDB: d1bl2a2, d1bl2a3, d1bl2a4, d1bl2b2, d1bl2b3, d1bl2b4 automated match to d1f13a1 complexed with sr |
PDB Entry: 1bl2 (more details), 2.5 Å
SCOPe Domain Sequences for d1bl2b1:
Sequence, based on SEQRES records: (download)
>d1bl2b1 b.1.18.9 (B:10-190) Transglutaminase N-terminal domain {Human (Homo sapiens), blood isozyme [TaxId: 9606]}
grravppnnsnaaeddlptvelqgvvprgvnlqeflnvtsvhlfkerwdtnkvdhhtdky
ennklivrrgqsfyvqidfsrpydprrdlfrveyvigrypqenkgtyipvpivselqsgk
wgakivmredrsvrlsiqsspkcivgkfrmyvavwtpygvlrtsrnpetdtyilfnpwce
d
>d1bl2b1 b.1.18.9 (B:10-190) Transglutaminase N-terminal domain {Human (Homo sapiens), blood isozyme [TaxId: 9606]}
grravppnnsnaaeddlptvelqgvvlqeflnvtsvhlfkerwdtnkvdhhtdkyennkl
ivrrgqsfyvqidfsrpydprrdlfrveyvigrypqenkgtyipvpivselqsgkwgaki
vmredrsvrlsiqsspkcivgkfrmyvavwtpygvlrtsrnpetdtyilfnpwced
Timeline for d1bl2b1:
View in 3DDomains from other chains: (mouse over for more information) d1bl2a1, d1bl2a2, d1bl2a3, d1bl2a4 |