Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.5: Transglutaminase, two C-terminal domains [49309] (2 families) automatically mapped to Pfam PF00927 |
Family b.1.5.1: Transglutaminase, two C-terminal domains [49310] (1 protein) |
Protein Transglutaminase, two C-terminal domains [49311] (4 species) duplication |
Species Human (Homo sapiens), blood isozyme [TaxId:9606] [49312] (9 PDB entries) Coagulation factor XIII, |
Domain d1bl2a4: 1bl2 A:628-727 [302234] Other proteins in same PDB: d1bl2a1, d1bl2a2, d1bl2b1, d1bl2b2 automated match to d1f13a3 complexed with sr |
PDB Entry: 1bl2 (more details), 2.5 Å
SCOPe Domain Sequences for d1bl2a4:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bl2a4 b.1.5.1 (A:628-727) Transglutaminase, two C-terminal domains {Human (Homo sapiens), blood isozyme [TaxId: 9606]} tipeiiikvrgtqvvgsdmtvtveftnplketlrnvwvhldgpgvtrpmkkmfreirpns tvqweevcrpwvsghrkliasmssdslrhvygeldvqiqr
Timeline for d1bl2a4:
View in 3D Domains from other chains: (mouse over for more information) d1bl2b1, d1bl2b2, d1bl2b3, d1bl2b4 |