SCOPe 2.07: Domain d1bjyb3: 1bjy B:3-67

Lineage for d1bjyb3 (1bjy B:3-67)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (20 families)
   consists only of helices

5. Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (35 protein domains)

6. Protein Tetracyclin repressor (Tet-repressor, TetR) [46765] (1 species)

7. Species Escherichia coli [TaxId:562] [46766] (27 PDB entries)

8. Domain d1bjyb3: 1bjy B:3-67 [302228]
   Other proteins in same PDB: d1bjya4, d1bjya5, d1bjyb4, d1bjyb5
   automated match to d1bjza1
   complexed with ctc, mg

Details for d1bjyb3

PDB Entry: 1bjy, 2.7 Å

PDB Description: tetracycline chelated mg2+-ion initiates helix unwinding for tet repressor induction

PDB Compounds: (B:) tetracycline repressor

SCOPe Domain Sequences for d1bjyb3:

Sequence; same for both SEQRES and ATOM records:

>d1bjyb3 a.4.1.9 (B:3-67) Tetracyclin repressor (Tet-repressor, TetR) {Escherichia coli [TaxId: 562]}
rlnresvidaalellnetgidglttrklaqklgieqptlywhvknkralldalaveilar
hhdys

Timeline for d1bjyb3:

• d1bjyb3 first appeared in SCOPe 2.06