![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.1: Homeodomain-like [46689] (20 families) ![]() consists only of helices |
![]() | Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (35 proteins) |
![]() | Protein Tetracyclin repressor (Tet-repressor, TetR) [46765] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [46766] (27 PDB entries) |
![]() | Domain d1bjya3: 1bjy A:3-67 [302225] Other proteins in same PDB: d1bjya4, d1bjya5, d1bjyb4, d1bjyb5 automated match to d1bjza1 complexed with ctc, mg |
PDB Entry: 1bjy (more details), 2.7 Å
SCOPe Domain Sequences for d1bjya3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bjya3 a.4.1.9 (A:3-67) Tetracyclin repressor (Tet-repressor, TetR) {Escherichia coli [TaxId: 562]} rlnresvidaalellnetgidglttrklaqklgieqptlywhvknkralldalaveilar hhdys
Timeline for d1bjya3: