Lineage for d1bj0a4 (1bj0 A:68-208)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2340898Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
    multihelical; interlocked (homo)dimer
  4. 2340899Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families) (S)
  5. 2340900Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 proteins)
  6. 2341170Protein Tetracyclin repressor (Tet-repressor, TetR) [48500] (1 species)
  7. 2341171Species Escherichia coli [TaxId:562] [48501] (37 PDB entries)
  8. 2341209Domain d1bj0a4: 1bj0 A:68-208 [302223]
    Other proteins in same PDB: d1bj0a3, d1bj0a5
    automated match to d1bjza2
    complexed with ctc

Details for d1bj0a4

PDB Entry: 1bj0 (more details), 2.4 Å

PDB Description: tetracycline chelated mg2+-ion initiates helix unwinding for tet repressor induction
PDB Compounds: (A:) tetracycline repressor

SCOPe Domain Sequences for d1bj0a4:

Sequence, based on SEQRES records: (download)

>d1bj0a4 a.121.1.1 (A:68-208) Tetracyclin repressor (Tet-repressor, TetR) {Escherichia coli [TaxId: 562]}
lpaageswqsflrnnamsfrrallryrdgakvhlgtrpdekqydtvetqlrfmtengfsl
rdglyaisavshftlgavleqqehtaaltdrpaapdenlppllrealqimdsddgeqafl
hgleslirgfevqltallqiv

Sequence, based on observed residues (ATOM records): (download)

>d1bj0a4 a.121.1.1 (A:68-208) Tetracyclin repressor (Tet-repressor, TetR) {Escherichia coli [TaxId: 562]}
lpaageswqsflrnnamsfrrallryrdgakvhlgtrpdekqydtvetqlrfmtengfsl
rdglyaisavshftlgavleqqehlppllrealqimdsddgeqaflhgleslirgfevql
tallqiv

SCOPe Domain Coordinates for d1bj0a4:

Click to download the PDB-style file with coordinates for d1bj0a4.
(The format of our PDB-style files is described here.)

Timeline for d1bj0a4: