Lineage for d1baqa_ (1baq A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2719091Fold a.79: NusB-like [48012] (1 superfamily)
    6 helices: bundle; one central helix is surrounded by 5 others
  4. 2719092Superfamily a.79.1: NusB-like [48013] (4 families) (S)
  5. 2719093Family a.79.1.1: Antitermination factor NusB [48014] (2 proteins)
    automatically mapped to Pfam PF01029
  6. 2719094Protein Antitermination factor NusB [48015] (3 species)
  7. 2719095Species Escherichia coli [TaxId:562] [48017] (2 PDB entries)
  8. 2719096Domain d1baqa_: 1baq A: [302220]
    automated match to d1ey1a_

Details for d1baqa_

PDB Entry: 1baq (more details)

PDB Description: antitermination factor nusb from escherichia coli, nmr, 18 structures
PDB Compounds: (A:) antitermination factor nusb

SCOPe Domain Sequences for d1baqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1baqa_ a.79.1.1 (A:) Antitermination factor NusB {Escherichia coli [TaxId: 562]}
mkpaarrrarecavqalyswqlsqndiadveyqflaeqdvkdvdvlyfrellagvatnta
yldglmkpylsrlleelgqvekavlrialyelskrsdvpykvaineaielaksfgaedsh
kfvngvldkaapvirpnkk

SCOPe Domain Coordinates for d1baqa_:

Click to download the PDB-style file with coordinates for d1baqa_.
(The format of our PDB-style files is described here.)

Timeline for d1baqa_: