![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.29: Bromodomain-like [47363] (15 superfamilies) 4 helices; bundle; minor mirror variant of up-and-down topology |
![]() | Superfamily a.29.2: Bromodomain [47370] (2 families) ![]() |
![]() | Family a.29.2.1: Bromodomain [47371] (6 proteins) |
![]() | Protein automated matches [190366] (2 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187201] (46 PDB entries) |
![]() | Domain d1b91a1: 1b91 A:720-832 [302219] Other proteins in same PDB: d1b91a2 automated match to d1wuma_ |
PDB Entry: 1b91 (more details)
SCOPe Domain Sequences for d1b91a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b91a1 a.29.2.1 (A:720-832) automated matches {Human (Homo sapiens) [TaxId: 9606]} keprdpdqlystlksilqqvkshqsawpfmepvkrteapgyyevirspmdlktmserlkn ryyvskklfmadlqrvftnckeynapeseyykcanilekfffskikeaglidk
Timeline for d1b91a1: