Lineage for d1b8ba_ (1b8b A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2097778Fold c.7: PFL-like glycyl radical enzymes [51997] (1 superfamily)
    contains: barrel, closed; n=10, S=10; accommodates a hairpin loop inside the barrel
  4. 2097779Superfamily c.7.1: PFL-like glycyl radical enzymes [51998] (6 families) (S)
    duplication: the N- and C-terminal halves have similar topologies
  5. 2097842Family c.7.1.3: Class III anaerobic ribonucleotide reductase NRDD subunit [52005] (2 protein domains)
    automatically mapped to Pfam PF13597
  6. 2097851Protein automated matches [310834] (1 species)
    not a true protein
  7. 2097852Species Bacteriophage T4 [TaxId:10665] [311117] (1 PDB entry)
  8. 2097853Domain d1b8ba_: 1b8b A: [302218]
    automated match to d1h7aa_

Details for d1b8ba_

PDB Entry: 1b8b (more details), 2.75 Å

PDB Description: class iii anaerobic ribonucleotide triphosphate reductase nrdd subunit, from bacteriophage t4
PDB Compounds: (A:) protein (anaerobic ribonucleotide-triphosphate reductase large chain)

SCOPe Domain Sequences for d1b8ba_:

Sequence, based on SEQRES records: (download)

>d1b8ba_ c.7.1.3 (A:) automated matches {Bacteriophage T4 [TaxId: 10665]}
srvfptqrdlmagivskhiaknmvpsfimkahesgiihvhdidyspalpftncclvdlkg
mlengfklgnaqietpksigvataimaqitaqvashqyggttfanvdkvlspyvkrtyak
hiedaekwqiadalnyaqsktekdvydafqayeyevntlfssngqtpfvtltfgtgtdwt
ermiqkailknrikglgrdgitpifpklvmfveegvnlykddpnydikqlalecaskrmy
pdiisaknnkaitgssvpvspmgcrsflsvwkdstgneildgrnnlgvvtlnlprialds
yigtqfneqkfvelfnermdlcfealmcrisslkgvkatvapilyqegafgvrlkpdddi
ielfkngrssvslgyigihelnilvgrdigreiltkmnahlkqwtertgfafslystpae
nlcyrfckldtekygsvkdvtdkgwytnsfhvsveenitpfekisreapyhfiatgghis
yvelpdmknnlkgleavwdyaaqhldyfgvnmpvdkcftcgsthemtptengfvcsicge
tdpkkmntirrtcaylgnpnerg

Sequence, based on observed residues (ATOM records): (download)

>d1b8ba_ c.7.1.3 (A:) automated matches {Bacteriophage T4 [TaxId: 10665]}
srvfptqrdlmagivskhiaknmvpsfimkahesgiihvhdidyspalpftncclvdlkg
mlengfklgnaqietpksigvataimaqitaqvashqyggttfanvdkvlspyvkrtyak
hiedaekwqiadalnyaqsktekdvydafqayeyevntlfssngqtpfvtltfgtgtdwt
ermiqkailknrikglgrdgitpifpklvmfveegvnlykddpnydikqlalecaskrmy
pdiisaknnkaitgssvpvspmgcrsflsvwkdstgneildgrnnlgvvtlnlprialds
yigtqfneqkfvelfnermdlcfealmcrisslkgvkatvapilyqegafgvrlkpdddi
ielfkngrssvslgyigihelnilvgrdigreiltkmnahlkqwtertgfafslystpae
nlcyrfckldtekygsvkdvtdkgwytnsfhvsveenitpfekisreapyhfiatgghis
yvelpdmknnlkgleavwdyaaqhldyfgvnmpvdkcntirrtcaylgnpnerg

SCOPe Domain Coordinates for d1b8ba_:

Click to download the PDB-style file with coordinates for d1b8ba_.
(The format of our PDB-style files is described here.)

Timeline for d1b8ba_:

  • d1b8ba_ is new in SCOPe 2.06-stable