Lineage for d1b6ob_ (1b6o B:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2391025Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 2391026Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 2391027Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 protein domains)
    dimer of identical mono-domain chains, each containing (6,10) barrel
  6. 2391043Protein Human immunodeficiency virus type 1 protease [50632] (9 species)
  7. 2391207Species Human immunodeficiency virus type 1 (arv2/sf2 isolate) [311116] (2 PDB entries)
  8. 2391209Domain d1b6ob_: 1b6o B: [302217]
    automated match to d1b6la_
    complexed with pi2, so4

Details for d1b6ob_

PDB Entry: 1b6o (more details), 1.85 Å

PDB Description: hiv-1 protease complexed with macrocyclic peptidomimetic inhibitor 2
PDB Compounds: (B:) retropepsin

SCOPe Domain Sequences for d1b6ob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b6ob_ b.50.1.1 (B:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1 (arv2/sf2 isolate)}
pqitlwkrplvtiriggqlkealldtgaddtvieemnlpgkwkpkmiggiggfikvrqyd
qipveiaghkaigtvlvgptpvniigrnlltqigatlnf

SCOPe Domain Coordinates for d1b6ob_:

Click to download the PDB-style file with coordinates for d1b6ob_.
(The format of our PDB-style files is described here.)

Timeline for d1b6ob_: