Class b: All beta proteins [48724] (178 folds) |
Fold b.50: Acid proteases [50629] (1 superfamily) barrel, closed; n=6, S=10, complex topology |
Superfamily b.50.1: Acid proteases [50630] (4 families) |
Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins) dimer of identical mono-domain chains, each containing (6,10) barrel |
Protein Human immunodeficiency virus type 1 protease [50632] (9 species) |
Species Human immunodeficiency virus type 1 (arv2/sf2 isolate) [311116] (2 PDB entries) |
Domain d1b6na_: 1b6n A: [302215] automated match to d1b6la_ complexed with pi3, so4 |
PDB Entry: 1b6n (more details), 1.85 Å
SCOPe Domain Sequences for d1b6na_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b6na_ b.50.1.1 (A:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1 (arv2/sf2 isolate)} pqitlwkrplvtiriggqlkealldtgaddtvieemnlpgkwkpkmiggiggfikvrqyd qipveiaghkaigtvlvgptpvniigrnlltqigatlnf
Timeline for d1b6na_: