Lineage for d1b6na_ (1b6n A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2408655Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 2408656Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 2408657Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
    dimer of identical mono-domain chains, each containing (6,10) barrel
  6. 2408673Protein Human immunodeficiency virus type 1 protease [50632] (9 species)
  7. 2408848Species Human immunodeficiency virus type 1 (arv2/sf2 isolate) [311116] (2 PDB entries)
  8. 2408851Domain d1b6na_: 1b6n A: [302215]
    automated match to d1b6la_
    complexed with pi3, so4

Details for d1b6na_

PDB Entry: 1b6n (more details), 1.85 Å

PDB Description: hiv-1 protease complexed with macrocyclic peptidomimetic inhibitor 3
PDB Compounds: (A:) retropepsin

SCOPe Domain Sequences for d1b6na_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b6na_ b.50.1.1 (A:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1 (arv2/sf2 isolate)}
pqitlwkrplvtiriggqlkealldtgaddtvieemnlpgkwkpkmiggiggfikvrqyd
qipveiaghkaigtvlvgptpvniigrnlltqigatlnf

SCOPe Domain Coordinates for d1b6na_:

Click to download the PDB-style file with coordinates for d1b6na_.
(The format of our PDB-style files is described here.)

Timeline for d1b6na_: