SCOPe 2.06: Domain d1az9a2: 1az9 A:177-440

Lineage for d1az9a2 (1az9 A:177-440)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.127: Creatinase/aminopeptidase [55919] (1 superfamily)
   duplication: composed of two very similar alpha+beta folds

4. Superfamily d.127.1: Creatinase/aminopeptidase [55920] (2 families)

5. Family d.127.1.1: Creatinase/aminopeptidase [55921] (4 proteins)

6. Protein Aminopeptidase P, C-terminal domain [55928] (2 species)

7. Species Escherichia coli [TaxId:562] [55929] (20 PDB entries)

8. Domain d1az9a2: 1az9 A:177-440 [302210]
   Other proteins in same PDB: d1az9a1
   automated match to d1n51a2
   complexed with mn

Details for d1az9a2

PDB Entry: 1az9, 2 Å

PDB Description: aminopeptidase p from e. coli

PDB Compounds: (A:) aminopeptidase p

SCOPe Domain Sequences for d1az9a2:

Sequence; same for both SEQRES and ATOM records:

>d1az9a2 d.127.1.1 (A:177-440) Aminopeptidase P, C-terminal domain {Escherichia coli [TaxId: 562]}
speeiavlrrageitamahtramekcrpgmfeyhlegeihhefnrhgarypsyntivgsg
engcilhytenecemrdgdlvlidagceykgyagditrtfpvngkftqaqreiydivles
letslrlyrpgtsilevtgevvrimvsglvklgilkgdvdeliaqnahrpffmhglshwl
gldvhdvgvygqdrsrilepgmvltvepglyiapdaevpeqyrgigirieddivitetgn
enltasvvkkpeeiealmvaarkq

Timeline for d1az9a2:

• d1az9a2 is new in SCOPe 2.06-stable
  
• d1az9a2 appears in SCOPe 2.07
  
• d1az9a2 appears in the current release, SCOPe 2.08