Lineage for d1hrdc1 (1hrd C:195-449)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1346342Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1346343Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1349489Family c.2.1.7: Aminoacid dehydrogenase-like, C-terminal domain [51883] (12 proteins)
    extra N-terminal helix displaces the C-terminal helix (following strand 6) from its usual position creating a family nicotineamide-binding site
  6. 1349490Protein Glutamate dehydrogenase [51884] (8 species)
  7. 1349491Species Clostridium symbiosum [TaxId:1512] [51885] (4 PDB entries)
  8. 1349496Domain d1hrdc1: 1hrd C:195-449 [30221]
    Other proteins in same PDB: d1hrda2, d1hrdb2, d1hrdc2

Details for d1hrdc1

PDB Entry: 1hrd (more details), 1.96 Å

PDB Description: glutamate dehydrogenase
PDB Compounds: (C:) glutamate dehydrogenase

SCOPe Domain Sequences for d1hrdc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hrdc1 c.2.1.7 (C:195-449) Glutamate dehydrogenase {Clostridium symbiosum [TaxId: 1512]}
karsfggslvrpeatgygsvyyveavmkhendtlvgktvalagfgnvawgaakklaelga
kavtlsgpdgyiydpegitteekinymlemrasgrnkvqdyadkfgvqffpgekpwgqkv
diimpcatqndvdleqakkivannvkyyievanmpttnealrflmqqpnmvvapskavna
ggvlvsgfemsqnserlswtaeevdsklhqvmtdihdgsaaaaeryglgynlvaganivg
fqkiadammaqgiaw

SCOPe Domain Coordinates for d1hrdc1:

Click to download the PDB-style file with coordinates for d1hrdc1.
(The format of our PDB-style files is described here.)

Timeline for d1hrdc1: