Lineage for d1ayqb_ (1ayq B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2513202Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily)
    consists of two intertwined (sub)domains related by pseudo dyad; duplication
    3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest
  4. 2513203Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families) (S)
    the constituent families form similar dimers
  5. 2513204Family c.77.1.1: Dimeric isocitrate & isopropylmalate dehydrogenases [53660] (4 proteins)
    the active site is between the two identical subunits
  6. 2513205Protein 3-isopropylmalate dehydrogenase, IPMDH [53661] (11 species)
  7. 2513206Species Bacillus coagulans [TaxId:1398] [53664] (2 PDB entries)
  8. 2513208Domain d1ayqb_: 1ayq B: [302208]
    automated match to d2ayqb_

Details for d1ayqb_

PDB Entry: 1ayq (more details), 3 Å

PDB Description: 3-isopropylmalate dehydrogenase from the moderate facultative thermophile, bacillus coagulans
PDB Compounds: (B:) 3-isopropylmalate dehydrogenase

SCOPe Domain Sequences for d1ayqb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ayqb_ c.77.1.1 (B:) 3-isopropylmalate dehydrogenase, IPMDH {Bacillus coagulans [TaxId: 1398]}
mkmklavlpgdgigpevmdaairvlktvldndgheavfenaliggaaideagtplpeetl
dicrrsdaillgavggpkwdhnpaslrpekgllglrkemglfanlrpvkayatllnaspl
krervenvdlvivreltgglyfgrpserrgpgenevvdtlaytreeieriiekafqlaqi
rrkklasvdkanvlessrmwreiaeetakkypdvelshmlvdstsmqlianpgqfdvivt
enmfgdilsdeasvitgslgmlpsaslrsdrfgmyepvhgsapdiagqgkanplgtvlsa
almlrysfglekeaaaiekavddvlqdgyctgdlqvangkvvstieltdrlieklnn

SCOPe Domain Coordinates for d1ayqb_:

Click to download the PDB-style file with coordinates for d1ayqb_.
(The format of our PDB-style files is described here.)

Timeline for d1ayqb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ayqa_