SCOPe 2.08: Domain d1ayqa_: 1ayq A:

Lineage for d1ayqa_ (1ayq A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily)
   consists of two intertwined (sub)domains related by pseudo dyad; duplication
   3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest

4. Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families)
   the constituent families form similar dimers

5. Family c.77.1.1: Dimeric isocitrate & isopropylmalate dehydrogenases [53660] (4 proteins)
   the active site is between the two identical subunits

6. Protein 3-isopropylmalate dehydrogenase, IPMDH [53661] (11 species)

7. Species Bacillus coagulans [TaxId:1398] [53664] (2 PDB entries)

8. Domain d1ayqa_: 1ayq A: [302207]
   automated match to d2ayqb_

Details for d1ayqa_

PDB Entry: 1ayq, 3 Å

PDB Description: 3-isopropylmalate dehydrogenase from the moderate facultative thermophile, bacillus coagulans

PDB Compounds: (A:) 3-isopropylmalate dehydrogenase

SCOPe Domain Sequences for d1ayqa_:

Sequence; same for both SEQRES and ATOM records:

>d1ayqa_ c.77.1.1 (A:) 3-isopropylmalate dehydrogenase, IPMDH {Bacillus coagulans [TaxId: 1398]}
mkmklavlpgdgigpevmdaairvlktvldndgheavfenaliggaaideagtplpeetl
dicrrsdaillgavggpkwdhnpaslrpekgllglrkemglfanlrpvkayatllnaspl
krervenvdlvivreltgglyfgrpserrgpgenevvdtlaytreeieriiekafqlaqi
rrkklasvdkanvlessrmwreiaeetakkypdvelshmlvdstsmqlianpgqfdvivt
enmfgdilsdeasvitgslgmlpsaslrsdrfgmyepvhgsapdiagqgkanplgtvlsa
almlrysfglekeaaaiekavddvlqdgyctgdlqvangkvvstieltdrliekln

Timeline for d1ayqa_:

• d1ayqa_ first appeared in SCOPe 2.06
  
• d1ayqa_ appears in SCOPe 2.07