SCOPe 2.06: Domain d1auba_: 1aub A:

Lineage for d1auba_ (1aub A:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.10: N-terminal Zn binding domain of HIV integrase [46919] (1 family)

5. Family a.4.10.1: N-terminal Zn binding domain of HIV integrase [46920] (1 protein)
   Zn-binding site is near the C-terminus

6. Protein N-terminal Zn binding domain of HIV integrase [46921] (2 species)

7. Species Human immunodeficiency virus type 2 [TaxId:11709] [46923] (2 PDB entries)

8. Domain d1auba_: 1aub A: [302202]
   automated match to d1e0ea_
   complexed with zn

Details for d1auba_

PDB Entry: 1aub

PDB Description: n-terminal domain of hiv-2 integrase, nmr, 20 structures

PDB Compounds: (A:) hiv-2 integrase

SCOPe Domain Sequences for d1auba_:

Sequence; same for both SEQRES and ATOM records:

>d1auba_ a.4.10.1 (A:) N-terminal Zn binding domain of HIV integrase {Human immunodeficiency virus type 2 [TaxId: 11709]}
flekiepaqeehekyhsnvkelshkfgipnlvarqivnscaqcqqk

Timeline for d1auba_:

• d1auba_ is new in SCOPe 2.06-stable
  
• d1auba_ appears in SCOPe 2.07
  
• d1auba_ appears in the current release, SCOPe 2.08