Lineage for d1aa8a3 (1aa8 A:1-194,A:288-340)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2850289Fold c.4: Nucleotide-binding domain [51970] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; Rossmann-like
  4. 2850290Superfamily c.4.1: Nucleotide-binding domain [51971] (3 families) (S)
    this superfamily shares the common nucleotide-binding site with and provides a link between the Rossmann-fold NAD(P)-binding and FAD/NAD(P)-binding domains
  5. 2850360Family c.4.1.2: D-aminoacid oxidase, N-terminal domain [51979] (1 protein)
    This family is probably related to the FAD-linked reductases and shares with them the C-terminal domain fold
  6. 2850361Protein D-aminoacid oxidase, N-terminal domain [51980] (2 species)
  7. 2850362Species Pig (Sus scrofa) [TaxId:9823] [51981] (7 PDB entries)
  8. 2850365Domain d1aa8a3: 1aa8 A:1-194,A:288-340 [302197]
    Other proteins in same PDB: d1aa8a4, d1aa8b4
    automated match to d1ve9a1
    complexed with bez, fad

Details for d1aa8a3

PDB Entry: 1aa8 (more details), 2.5 Å

PDB Description: porcine kidney d-amino acid oxidase
PDB Compounds: (A:) d-amino acid oxidase

SCOPe Domain Sequences for d1aa8a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aa8a3 c.4.1.2 (A:1-194,A:288-340) D-aminoacid oxidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}
mrvvvigagviglstalciheryhsvlqpldvkvyadrftpftttdvaaglwqpytseps
npqeanwnqqtfnyllshigspnaanmgltpvsgynlfreavpdpywkdmvlgfrkltpr
eldmfpdyrygwfntslilegrkylqwlterltergvkfflrkvesfeevarggadviin
ctgvwagvlqpdplXqvrlereqlrfgssntevihnyghggygltihwgcalevaklfgk
vleernll

SCOPe Domain Coordinates for d1aa8a3:

Click to download the PDB-style file with coordinates for d1aa8a3.
(The format of our PDB-style files is described here.)

Timeline for d1aa8a3:

View in 3D
Domains from same chain:
(mouse over for more information)
d1aa8a4