Lineage for d1a10i_ (1a10 I:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2512772Fold d.40: CI-2 family of serine protease inhibitors [54653] (1 superfamily)
    alpha+beta sandwich; loop across free side of beta-sheet
  4. 2512773Superfamily d.40.1: CI-2 family of serine protease inhibitors [54654] (2 families) (S)
  5. 2512774Family d.40.1.1: CI-2 family of serine protease inhibitors [54655] (5 protein domains)
    automatically mapped to Pfam PF00280
  6. 2512827Protein automated matches [190792] (4 species)
    not a true protein
  7. 2512834Species Hordeum vulgare [TaxId:112509] [311115] (1 PDB entry)
  8. 2512835Domain d1a10i_: 1a10 I: [302190]
    Other proteins in same PDB: d1a10e_
    automated match to d2ci2i_
    complexed with ca, na

Details for d1a10i_

PDB Entry: 1a10 (more details), 1.8 Å

PDB Description: alcalase (subtilisin carlsberg variant) in complex with chymotrypsin inhibitor ci-2a(m59p)
PDB Compounds: (I:) subtilisin-chymotrypsin inhibitor-2

SCOPe Domain Sequences for d1a10i_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a10i_ d.40.1.1 (I:) automated matches {Hordeum vulgare [TaxId: 112509]}
ktewpelvgksveeakkvilqdkpeaqiivlpvgtivtpeyridrvrlfvdkldniaevp
rvg

SCOPe Domain Coordinates for d1a10i_:

Click to download the PDB-style file with coordinates for d1a10i_.
(The format of our PDB-style files is described here.)

Timeline for d1a10i_: