SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1a10i_ (1a10 I:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2168703Fold d.40: CI-2 family of serine protease inhibitors [54653] (1 superfamily)
    alpha+beta sandwich; loop across free side of beta-sheet
  4. 2168704Superfamily d.40.1: CI-2 family of serine protease inhibitors [54654] (2 families) (S)
  5. 2168705Family d.40.1.1: CI-2 family of serine protease inhibitors [54655] (5 protein domains)
    automatically mapped to Pfam PF00280
  6. 2168758Protein automated matches [190792] (4 species)
    not a true protein
  7. 2168761Species Hordeum vulgare [TaxId:112509] [311115] (1 PDB entry)
  8. 2168762Domain d1a10i_: 1a10 I: [302190]
    Other proteins in same PDB: d1a10e_
    automated match to d2ci2i_
    complexed with ca, na

Details for d1a10i_

PDB Entry: 1a10 (more details), 1.8 Å

PDB Description: alcalase (subtilisin carlsberg variant) in complex with chymotrypsin inhibitor ci-2a(m59p)
PDB Compounds: (I:) subtilisin-chymotrypsin inhibitor-2

SCOPe Domain Sequences for d1a10i_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a10i_ d.40.1.1 (I:) automated matches {Hordeum vulgare [TaxId: 112509]}
ktewpelvgksveeakkvilqdkpeaqiivlpvgtivtpeyridrvrlfvdkldniaevp
rvg

SCOPe Domain Coordinates for d1a10i_:

Click to download the PDB-style file with coordinates for d1a10i_.
(The format of our PDB-style files is described here.)

Timeline for d1a10i_:

  • d1a10i_ is new in SCOPe 2.06-stable