Class a: All alpha proteins [46456] (289 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) |
Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
Protein Hemoglobin, alpha-chain [46486] (24 species) |
Species Human (Homo sapiens) [TaxId:9606] [46487] (287 PDB entries) Uniprot P69905 P01922 P01934 P01935 |
Domain d1a0ya_: 1a0y A: [302185] Other proteins in same PDB: d1a0yb_, d1a0yd_ automated match to d1irda_ complexed with hem; mutant |
PDB Entry: 1a0y (more details), 1.98 Å
SCOPe Domain Sequences for d1a0ya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a0ya_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Human (Homo sapiens) [TaxId: 9606]} vlspadktnvkaawgkvgahageygaealermflsfpttktyfphfdlshgsaqvkghgk kvadaltnavahvddmpnalsalsdlhahklrvdpvnfkllshcllvtlaahlpaeftpa vhasldkflasvstvltskyr
Timeline for d1a0ya_: