Lineage for d1k89_1 (1k89 195-449)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 307887Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 307888Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (10 families) (S)
  5. 309102Family c.2.1.7: Aminoacid dehydrogenase-like, C-terminal domain [51883] (10 proteins)
    extra N-terminal helix displaces the C-terminal helix (following strand 6) from its usual position creating a family nicotineamide-binding site
  6. 309103Protein Glutamate dehydrogenase [51884] (7 species)
  7. 309122Species Clostridium symbiosum [TaxId:1512] [51885] (4 PDB entries)
  8. 309124Domain d1k89_1: 1k89 195-449 [30218]
    Other proteins in same PDB: d1k89_2
    mutant

Details for d1k89_1

PDB Entry: 1k89 (more details), 2.05 Å

PDB Description: k89l mutant of glutamate dehydrogenase

SCOP Domain Sequences for d1k89_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k89_1 c.2.1.7 (195-449) Glutamate dehydrogenase {Clostridium symbiosum}
karsfggslvrpeatgygsvyyveavmkhendtlvgktvalagfgnvawgaakklaelga
kavtlsgpdgyiydpegitteekinymlemrasgrnkvqdyadkfgvqffpgekpwgqkv
diimpcatqndvdleqakkivannvkyyievanmpttnealrflmqqpnmvvapskavna
ggvlvsgfemsqnserlswtaeevdsklhqvmtdihdgsaaaaeryglgynlvaganivg
fqkiadammaqgiaw

SCOP Domain Coordinates for d1k89_1:

Click to download the PDB-style file with coordinates for d1k89_1.
(The format of our PDB-style files is described here.)

Timeline for d1k89_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1k89_2