Lineage for d179la_ (179l A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2531350Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 2531351Superfamily d.2.1: Lysozyme-like [53955] (12 families) (S)
  5. 2532819Family d.2.1.3: Phage lysozyme [53981] (4 proteins)
  6. 2532825Protein Phage T4 lysozyme [53982] (1 species)
  7. 2532826Species Bacteriophage T4 [TaxId:10665] [53983] (595 PDB entries)
    Uniprot P00720
    many mutant structures
  8. 2533481Domain d179la_: 179l A: [302179]
    automated match to d177la_

Details for d179la_

PDB Entry: 179l (more details), 2.7 Å

PDB Description: protein flexibility and adaptability seen in 25 crystal forms of t4 lysozyme
PDB Compounds: (A:) t4 lysozyme

SCOPe Domain Sequences for d179la_:

Sequence; same for both SEQRES and ATOM records: (download)

>d179la_ d.2.1.3 (A:) Phage T4 lysozyme {Bacteriophage T4 [TaxId: 10665]}
mnifemlrideglrlkiykdtegyytigighlltkspslnaakseldkaigrntngvitk
deaeklfnqdvdaavrgilrnaklkpvydsldavrraalinmvfqmgetgvagftnslrm
lqqkrwceaavnlaksrwynqtpnrakrvittfctgtwdayk

SCOPe Domain Coordinates for d179la_:

Click to download the PDB-style file with coordinates for d179la_.
(The format of our PDB-style files is described here.)

Timeline for d179la_: