SCOPe 2.08: Domain d5feaa_: 5fea A:

Lineage for d5feaa_ (5fea A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.2: Bromodomain [47370] (2 families)

5. Family a.29.2.0: automated matches [191428] (1 protein)
   not a true family

6. Protein automated matches [190615] (15 species)
   not a true protein

7. Species Leishmania donovani [TaxId:981087] [274710] (2 PDB entries)

8. Domain d5feaa_: 5fea A: [302174]
   automated match to d5c8ga_
   complexed with bmf, br

Details for d5feaa_

PDB Entry: 5fea, 2.6 Å

PDB Description: domain swapped bromodomain from leishmania donovani

PDB Compounds: (A:) Uncharacterized protein

SCOPe Domain Sequences for d5feaa_:

Sequence; same for both SEQRES and ATOM records:

>d5feaa_ a.29.2.0 (A:) automated matches {Leishmania donovani [TaxId: 981087]}
hprplpagkhahrqsletipevaelyhciyklyneeessvwfrepvnalaqeiftyydvv
kspmslrhildnivkgdtystalqvmedveliwkncitfngansllateagkcrsaldri
rrayq

Timeline for d5feaa_:

• d5feaa_ first appeared in SCOPe 2.06
  
• d5feaa_ appears in SCOPe 2.07