Lineage for d1bg6_2 (1bg6 4-187)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 574151Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 574152Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) (S)
  5. 575826Family c.2.1.6: 6-phosphogluconate dehydrogenase-like, N-terminal domain [51868] (15 proteins)
    the beta-sheet is extended to 8 strands, order 32145678; strands 7 & 8 are antiparallel to the rest
    C-terminal domains also show some similarity
  6. 575914Protein N-(1-D-carboxylethyl)-L-norvaline dehydrogenase [51879] (1 species)
  7. 575915Species Arthrobacter, strain 1c [TaxId:1663] [51880] (1 PDB entry)
  8. 575916Domain d1bg6_2: 1bg6 4-187 [30214]
    Other proteins in same PDB: d1bg6_1

Details for d1bg6_2

PDB Entry: 1bg6 (more details), 1.8 Å

PDB Description: crystal structure of the n-(1-d-carboxylethyl)-l-norvaline dehydrogenase from arthrobacter sp. strain 1c

SCOP Domain Sequences for d1bg6_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bg6_2 c.2.1.6 (4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c}
sktyavlglgngghafaaylalkgqsvlawdidaqrikeiqdrgaiiaegpglagtahpd
lltsdiglavkdadvilivvpaihhasiaaniasyisegqliilnpgatggalefrkilr
engapevtigetssmlftcrserpgqvtvnaikgamdfaclpaakagwaleqigsvlpqy
vave

SCOP Domain Coordinates for d1bg6_2:

Click to download the PDB-style file with coordinates for d1bg6_2.
(The format of our PDB-style files is described here.)

Timeline for d1bg6_2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1bg6_1