| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
| Family c.2.1.6: 6-phosphogluconate dehydrogenase-like, N-terminal domain [51868] (19 proteins) the beta-sheet is extended to 8 strands, order 32145678; strands 7 & 8 are antiparallel to the rest C-terminal domains also show some similarity |
| Protein UDP-glucose dehydrogenase (UDPGDH) [51877] (1 species) |
| Species Streptococcus pyogenes [TaxId:1314] [51878] (2 PDB entries) |
| Domain d1dlia2: 1dli A:1-196 [30213] Other proteins in same PDB: d1dlia1, d1dlia3 complexed with gol, nad, so4, udx |
PDB Entry: 1dli (more details), 2.31 Å
SCOPe Domain Sequences for d1dlia2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dlia2 c.2.1.6 (A:1-196) UDP-glucose dehydrogenase (UDPGDH) {Streptococcus pyogenes [TaxId: 1314]}
mkiavagsgyvglslgvllslqnevtivdilpskvdkinnglspiqdeyieyylkskqls
ikatldskaaykeaelviiatptnynsrinyfdtqhvetvikevlsvnshatliikstip
igfitemrqkfqtdriifspeflreskalydnlypsriivsceendspkvkadaekfall
lksaakknnvpvlimg
Timeline for d1dlia2: