SCOPe 2.08: Domain d1dlia2: 1dli A:1-196

Lineage for d1dlia2 (1dli A:1-196)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.6: 6-phosphogluconate dehydrogenase-like, N-terminal domain [51868] (19 proteins)
   the beta-sheet is extended to 8 strands, order 32145678; strands 7 & 8 are antiparallel to the rest
   C-terminal domains also show some similarity

6. Protein UDP-glucose dehydrogenase (UDPGDH) [51877] (1 species)

7. Species Streptococcus pyogenes [TaxId:1314] [51878] (2 PDB entries)

8. Domain d1dlia2: 1dli A:1-196 [30213]
   Other proteins in same PDB: d1dlia1, d1dlia3
   complexed with gol, nad, so4, udx

Details for d1dlia2

PDB Entry: 1dli, 2.31 Å

PDB Description: the first structure of udp-glucose dehydrogenase (udpgdh) reveals the catalytic residues necessary for the two-fold oxidation

PDB Compounds: (A:) udp-glucose dehydrogenase

SCOPe Domain Sequences for d1dlia2:

Sequence; same for both SEQRES and ATOM records:

>d1dlia2 c.2.1.6 (A:1-196) UDP-glucose dehydrogenase (UDPGDH) {Streptococcus pyogenes [TaxId: 1314]}
mkiavagsgyvglslgvllslqnevtivdilpskvdkinnglspiqdeyieyylkskqls
ikatldskaaykeaelviiatptnynsrinyfdtqhvetvikevlsvnshatliikstip
igfitemrqkfqtdriifspeflreskalydnlypsriivsceendspkvkadaekfall
lksaakknnvpvlimg

Timeline for d1dlia2:

• d1dlia2 first appeared (with stable ids) in SCOP 1.55
  
• d1dlia2 appears in SCOPe 2.07