SCOPe 2.08: Domain d5e4eb1: 5e4e B:1-96

Lineage for d5e4eb1 (5e4e B:1-96)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (2 families)

5. Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
   Pfam PF00041

6. Protein automated matches [190888] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188282] (33 PDB entries)

8. Domain d5e4eb1: 5e4e B:1-96 [302127]
   Other proteins in same PDB: d5e4ea_
   automated match to d3bplb1
   complexed with nag, so4

Details for d5e4eb1

PDB Entry: 5e4e, 3 Å

PDB Description: engineered interleukin-13 bound to receptor

PDB Compounds: (B:) Interleukin-4 receptor subunit alpha

SCOPe Domain Sequences for d5e4eb1:

Sequence, based on SEQRES records:

>d5e4eb1 b.1.2.1 (B:1-96) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mkvlqeptcvsdymsistcewkmngptncstelrllyqlvfllseahtcipennggagcv
chllmddvvsadnytldlwagqqllwkgsfkpsehv

Sequence, based on observed residues (ATOM records):

>d5e4eb1 b.1.2.1 (B:1-96) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mkvlqeptcvsdymsistcewkmgptncstelrllyqlvfllseahtcipennggagcvc
hllmddvvsadnytldlwagqqllwkgsfkpsehv

Timeline for d5e4eb1:

• d5e4eb1 first appeared in SCOPe 2.06
  
• d5e4eb1 appears in SCOPe 2.07